PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004486392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 302aa    MW: 33018.7 Da    PI: 7.3071
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004486392.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.11.9e-334296155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  XP_004486392.1 42 KPRLRWTQDLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 96
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-323996IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-234296IPR006447Myb domain, plants
SuperFamilySSF466899.85E-174298IPR009057Homeodomain-like
PfamPF002491.9E-74495IPR001005SANT/Myb domain
PfamPF143792.1E-15126171IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MYPRLIHPHE GIVGQEDLQG GVGVGVSNHK GDPCLVLTAD PKPRLRWTQD LHERFVDAVT  60
QLGGASKATP KAIMRTMNVK GLTLFHLKSH LQKYRLGMTG SYLLESPGTD NTSPKLPTSD  120
TNEGYEIKEA LRAQMEVQSK LHLQVEAEKH LQIRQDAERR YMAMLERACK MLADQFIGAT  180
VIDTDNQKFQ GIGNKAPRGS LVDHLGFYSL PSTEVAGVNA PEEEIPPCLP SQRADCSTES  240
CLTSHESSGG LTLEGSPGVG KRRMLGMDSM AAPLIWSEAK MKTQAINLAQ GNNPLGITRY  300
GM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486392.10.0PREDICTED: uncharacterized protein LOC101503318 isoform X2
RefseqXP_004486393.10.0PREDICTED: uncharacterized protein LOC101503318 isoform X2
TrEMBLG7ISN70.0G7ISN7_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA09G02030.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-56G2-like family protein